DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr3K and Polr2I

DIOPT Version :10

Sequence 1:NP_001027443.1 Gene:Polr3K / 3772344 FlyBaseID:FBgn0061362 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_731898.1 Gene:Polr2I / 41741 FlyBaseID:FBgn0004855 Length:129 Species:Drosophila melanogaster


Alignment Length:118 Identity:37/118 - (31%)
Similarity:53/118 - (44%) Gaps:21/118 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FCPSCGNILIIEED----------TNC--HRFTCNTCPYISKIRRKISTKTFPRLKEVDHVLGGK 56
            ||..|.|:|..:||          .||  .:...:.|.|::||..:|.        |:.|::...
  Fly    20 FCQECNNMLYPKEDKENKILLYACRNCDYKQEADSNCIYVNKIMHEID--------ELTHIVPDV 76

  Fly    57 AAWENVDST-DAECPTCGHKRAYFMQIQTRSADEPMTTFYKCCNHECNHTWRD 108
            .:...:..| |..||.|.|:.|.|.|.|||.|:|.|..:|.|.|..|.|.|.:
  Fly    77 ISDPTLPRTEDHACPKCSHREAVFFQAQTRRAEEEMRLYYVCTNQNCTHRWTE 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr3KNP_001027443.1 RPB9 4..107 CDD:441202 36/115 (31%)
Zn-ribbon_RPC11 61..108 CDD:259794 21/47 (45%)
Polr2INP_731898.1 RPB9 19..129 CDD:441202 37/116 (32%)
Zn-ribbon_RPB9 78..128 CDD:259793 20/49 (41%)

Return to query results.
Submit another query.