DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33785 and tcea3

DIOPT Version :9

Sequence 1:NP_001027443.1 Gene:CG33785 / 3772344 FlyBaseID:FBgn0061362 Length:108 Species:Drosophila melanogaster
Sequence 2:XP_005158394.1 Gene:tcea3 / 402983 ZFINID:ZDB-GENE-040426-1860 Length:783 Species:Danio rerio


Alignment Length:139 Identity:37/139 - (26%)
Similarity:54/139 - (38%) Gaps:51/139 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TNCHRFTCNTCPYI------------SKIRRKISTKTFPR------------------------- 45
            |||.........||            :::|.:||....|:                         
Zfish   645 TNCEAMGAEIEDYIYQETKATDMKYKNRVRSRISNLKDPKNPNLRKNVLAGAIELSRIASMTAEE 709

  Fly    46 -----LKEVDHVLGGKAAWENV------DSTD-AECPTCGHKRAYFMQIQTRSADEPMTTFYKCC 98
                 ||::.:||..:|..|:.      .:|| .:|..|..|...:.|:||||||||||||..| 
Zfish   710 MASDELKQLRNVLTQEAIREHQMAKTGGTTTDLLQCGKCKKKNCTYNQVQTRSADEPMTTFVLC- 773

  Fly    99 NHECNHTWR 107
             :||.:.|:
Zfish   774 -NECGNRWK 781

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33785NP_001027443.1 RPB9 1..108 CDD:224510 37/139 (27%)
tcea3XP_005158394.1 TFIIS_I 4..80 CDD:238107
TFSII 5..>156 CDD:273592
TFIIS_M 620..727 CDD:284835 13/81 (16%)
Zn-ribbon_TFIIS 736..782 CDD:259796 22/48 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.