DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG33785 and tcea2

DIOPT Version :9

Sequence 1:	NP_001027443.1	Gene:	CG33785 / 3772344	FlyBaseID:	FBgn0061362	Length:	108	Species:	Drosophila melanogaster
Sequence 2:	NP_957280.2	Gene:	tcea2 / 393961	ZFINID:	ZDB-GENE-040426-985	Length:	301	Species:	Danio rerio

Alignment Length:	137	Identity:	36/137 - (26%)
Similarity:	53/137 - (38%)	Gaps:	39/137 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly     8 CGNILIIEEDTNCHRFTCNTCPYISKIRRKIST------------------------------KT 42
            |.::....||.....|......|.:::|.:||.                              ..
Zfish   165 CEHMAAQIEDYIYQEFKSTDMKYKTRLRSRISNLKDQKNPDLRRNVLCGNISPERIASMTAEEMA 229

  Fly    43 FPRLKEVDHVLGGKAAWEN----VDSTDAE---CPTCGHKRAYFMQIQTRSADEPMTTFYKCCNH 100
            .|.|||:...|..::..|:    |..|:.:   |..|..|...:.|:||||||||||||..|  :
Zfish   230 SPELKEIRKALTKESIREHQLSKVGGTETDMFVCGKCKGKNCTYTQVQTRSADEPMTTFVLC--N 292

  Fly   101 ECNHTWR 107
            ||.:.|:
Zfish   293 ECGNRWK 299

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG33785	NP_001027443.1	RPB9	1..108	CDD:224510	36/137 (26%)
tcea2	NP_957280.2	TFIIS_I	5..80	CDD:238107
		TFSII	6..301	CDD:273592	36/137 (26%)
		TFIIS_M	138..245	CDD:284835	13/79 (16%)
		Zn-ribbon_TFIIS	254..300	CDD:259796	21/48 (44%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG1594
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.810