DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33785 and Tceanc

DIOPT Version :9

Sequence 1:NP_001027443.1 Gene:CG33785 / 3772344 FlyBaseID:FBgn0061362 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_001102485.1 Gene:Tceanc / 367782 RGDID:1584894 Length:358 Species:Rattus norvegicus


Alignment Length:145 Identity:32/145 - (22%)
Similarity:49/145 - (33%) Gaps:59/145 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IEEDTNCHRFTCNT---CPYISKIRRKISTKTFPRLKEV-DHVLGG------------------- 55
            |||    |.||.::   ..|.:.||.|::....||...: .::|.|                   
  Rat   213 IEE----HIFTLHSNDIKKYKNNIRSKVANLNNPRNSHLQQNLLSGTISAREFAEMTVLDMANQE 273

  Fly    56 ----KAAW-----------ENVDSTDA---ECPTCGH---------KRAYFMQ--IQTRSADEPM 91
                :|::           :.||.|..   :|..|..         :...|:.  :|..:.||.|
  Rat   274 LKQLRASYIESSIQEHHLPQIVDGTHTNKIKCRRCDKYNCTVTVIARGTLFLPSWVQNSNPDEQM 338

  Fly    92 TTFYKCCNHECNHTW 106
            |  |..|| ||...|
  Rat   339 T--YVICN-ECGEQW 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33785NP_001027443.1 RPB9 1..108 CDD:224510 32/145 (22%)
TceancNP_001102485.1 TFSII 6..350 CDD:273592 31/143 (22%)
TFIIS_M 180..286 CDD:284835 15/76 (20%)
Zn-ribbon 297..350 CDD:295390 14/55 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.