DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33785 and Polr3k

DIOPT Version :9

Sequence 1:NP_001027443.1 Gene:CG33785 / 3772344 FlyBaseID:FBgn0061362 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_001014281.1 Gene:Polr3k / 366277 RGDID:1587294 Length:108 Species:Rattus norvegicus


Alignment Length:108 Identity:76/108 - (70%)
Similarity:85/108 - (78%) Gaps:0/108 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLFFCPSCGNILIIEEDTNCHRFTCNTCPYISKIRRKISTKTFPRLKEVDHVLGGKAAWENVDST 65
            ||.|||.|||.||:||...||||.||||||:..|.||::.:.:|:|||||.||||.|||||||||
  Rat     1 MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDST 65

  Fly    66 DAECPTCGHKRAYFMQIQTRSADEPMTTFYKCCNHECNHTWRD 108
            ...||.|.|.||||||:|||||||||||||||||.:|.|.|||
  Rat    66 AEPCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33785NP_001027443.1 RPB9 1..108 CDD:224510 74/106 (70%)
Polr3kNP_001014281.1 RPB9 1..108 CDD:224510 74/106 (70%)
Zn-ribbon_RPC11 61..108 CDD:259794 35/46 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336544
Domainoid 1 1.000 79 1.000 Domainoid score I8528
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5610
Inparanoid 1 1.050 180 1.000 Inparanoid score I3906
OMA 1 1.010 - - QHG54273
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004777
OrthoInspector 1 1.000 - - oto96356
orthoMCL 1 0.900 - - OOG6_101491
Panther 1 1.100 - - LDO PTHR11239
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3361
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.760

Return to query results.
Submit another query.