DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33785 and CG8117

DIOPT Version :9

Sequence 1:NP_001027443.1 Gene:CG33785 / 3772344 FlyBaseID:FBgn0061362 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster


Alignment Length:121 Identity:26/121 - (21%)
Similarity:41/121 - (33%) Gaps:43/121 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NTC--PYISKIRRKISTKTFPRLKEV--DHVLG-------GKAAWENVDSTDA------------ 67
            |.|  .|.::||.:::....|:..|:  ..:||       .|...|.:.|.|.            
  Fly    45 NGCKVKYKNRIRSRLANLRDPKNPELRQKFLLGQITPEELSKMTPEEMASDDMKQMRQKYVQDSI 109

  Fly    68 ----------------ECPTCGHKRAYFMQIQTRSADEPMTTFYKCCNHECNHTWR 107
                            :|..|..:..  .|:..|..|||:.||..|  .||.:.|:
  Fly   110 NAAQMAKVQGTKTDQFKCERCDKRNC--SQLHIRDGDEPIITFVIC--DECGNRWK 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33785NP_001027443.1 RPB9 1..108 CDD:224510 26/121 (21%)
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 13/63 (21%)
Zn-ribbon 118..161 CDD:295390 12/46 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.