DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33785 and rpc11

DIOPT Version :9

Sequence 1:NP_001027443.1 Gene:CG33785 / 3772344 FlyBaseID:FBgn0061362 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_593235.1 Gene:rpc11 / 2541521 PomBaseID:SPAC22A12.05 Length:109 Species:Schizosaccharomyces pombe


Alignment Length:114 Identity:54/114 - (47%)
Similarity:67/114 - (58%) Gaps:17/114 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FCPSCGNILII---EEDTNCHRFTCNTCPYISKIRRKISTKTFPR----LKEVDHVLGGKAAWEN 61
            |||:|||.||:   ||..|.  |.|.||||    ...|||..:.|    .||||.||||:.|:|:
pombe     3 FCPTCGNHLIVAVDEEGRNA--FDCRTCPY----HFPISTFLYSRHEFAQKEVDDVLGGEEAFES 61

  Fly    62 VDSTDAECPT--CGHKRAYFMQIQTRSADEPMTTFYKCCNHECNHTWRD 108
            ...|:..|..  |.:.||||.|:|.|||||||:|||:|.  :|...||:
pombe    62 NQQTEVTCENTKCDNNRAYFFQLQIRSADEPMSTFYRCT--KCKFQWRE 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33785NP_001027443.1 RPB9 1..108 CDD:224510 53/112 (47%)
rpc11NP_593235.1 RPB9 1..109 CDD:224510 54/114 (47%)
RPOL9 2..53 CDD:197822 25/55 (45%)
Zn-ribbon_RPC11 63..108 CDD:259794 22/46 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I3413
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5610
Inparanoid 1 1.050 94 1.000 Inparanoid score I1720
OMA 1 1.010 - - QHG54273
OrthoFinder 1 1.000 - - FOG0004777
OrthoInspector 1 1.000 - - oto100880
orthoMCL 1 0.900 - - OOG6_101491
Panther 1 1.100 - - LDO PTHR11239
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1188
SonicParanoid 1 1.000 - - X3361
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.