powered by:
Protein Alignment CG33785 and Tcea1
DIOPT Version :9
Sequence 1: | NP_001027443.1 |
Gene: | CG33785 / 3772344 |
FlyBaseID: | FBgn0061362 |
Length: | 108 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001153223.1 |
Gene: | Tcea1 / 21399 |
MGIID: | 1196624 |
Length: | 312 |
Species: | Mus musculus |
Alignment Length: | 69 |
Identity: | 28/69 - (40%) |
Similarity: | 37/69 - (53%) |
Gaps: | 9/69 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 LKEVDHVLGGKAAWEN----VDSTDAECPTCG---HKRAYFMQIQTRSADEPMTTFYKCCNHECN 103
|||:...|..:|..|: ...|..:..||| .|...:.|:||||||||||||..| :||.
Mouse 244 LKEMRKNLTKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVC--NECG 306
Fly 104 HTWR 107
:.|:
Mouse 307 NRWK 310
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1594 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.