DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33785 and rpb-9

DIOPT Version :9

Sequence 1:NP_001027443.1 Gene:CG33785 / 3772344 FlyBaseID:FBgn0061362 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_505062.1 Gene:rpb-9 / 179178 WormBaseID:WBGene00022400 Length:167 Species:Caenorhabditis elegans


Alignment Length:118 Identity:37/118 - (31%)
Similarity:55/118 - (46%) Gaps:21/118 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FCPSCGNILIIEED----------TNC-HR-FTCNTCPYISKIRRKISTKTFPRLKEVDHVLGGK 56
            |||.|.|:|...||          .|| || ...|.|.|::|:..:|.        |:..::|..
 Worm    58 FCPECNNMLYPREDKESRVLMYSCRNCEHREVAANPCIYVNKLVHEID--------ELTQIVGDI 114

  Fly    57 AAWENVDSTDA-ECPTCGHKRAYFMQIQTRSADEPMTTFYKCCNHECNHTWRD 108
            .....:..|:. :||.||..:|.|.|.||:.|:|.|..:|.|.:.:|.|.|.:
 Worm   115 IHDPTLPKTEEHQCPVCGKSKAVFFQAQTKKAEEEMRLYYVCASQDCQHRWTE 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33785NP_001027443.1 RPB9 1..108 CDD:224510 37/116 (32%)
rpb-9NP_505062.1 RPB9 56..167 CDD:224510 37/116 (32%)
Zn-ribbon_RPB9 116..166 CDD:259793 17/49 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.