DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33785 and rpc-11

DIOPT Version :9

Sequence 1:NP_001027443.1 Gene:CG33785 / 3772344 FlyBaseID:FBgn0061362 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_500076.1 Gene:rpc-11 / 176950 WormBaseID:WBGene00022309 Length:108 Species:Caenorhabditis elegans


Alignment Length:108 Identity:56/108 - (51%)
Similarity:74/108 - (68%) Gaps:0/108 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLFFCPSCGNILIIEEDTNCHRFTCNTCPYISKIRRKISTKTFPRLKEVDHVLGGKAAWENVDST 65
            ||.|||.||.:|.||....|.||:|..|||:..:.:.::::.:|:||::|.||||..||.|...|
 Worm     1 MLTFCPECGCVLQIESGEQCMRFSCPACPYVCPVTQTVTSRIYPKLKDIDDVLGGPGAWANAQVT 65

  Fly    66 DAECPTCGHKRAYFMQIQTRSADEPMTTFYKCCNHECNHTWRD 108
            |..||.|.|.||||||:||||||||.|.||:|.::.|.|.|:|
 Worm    66 DETCPVCSHGRAYFMQLQTRSADEPSTIFYRCADNACAHRWKD 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33785NP_001027443.1 RPB9 1..108 CDD:224510 55/106 (52%)
rpc-11NP_500076.1 RPB9 1..108 CDD:224510 55/106 (52%)
RPOL9 4..53 CDD:197822 19/48 (40%)
Zn-ribbon_RPC11 61..108 CDD:259794 28/46 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157337
Domainoid 1 1.000 67 1.000 Domainoid score I6468
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5610
Inparanoid 1 1.050 141 1.000 Inparanoid score I3068
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54273
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004777
OrthoInspector 1 1.000 - - oto20111
orthoMCL 1 0.900 - - OOG6_101491
Panther 1 1.100 - - LDO PTHR11239
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1188
SonicParanoid 1 1.000 - - X3361
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.890

Return to query results.
Submit another query.