DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA46a and CheA86a

DIOPT Version :9

Sequence 1:NP_001027399.1 Gene:CheA46a / 3772338 FlyBaseID:FBgn0262594 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001027174.1 Gene:CheA86a / 3772145 FlyBaseID:FBgn0261291 Length:189 Species:Drosophila melanogaster


Alignment Length:171 Identity:51/171 - (29%)
Similarity:84/171 - (49%) Gaps:9/171 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 HKVLLVLSIAHSALVRAGLECRIESISKVFGDNETLFEF-NFRVIGRQRLLNGTLNFHVDLDDD- 68
            :.||::|......|::|.:......:|....:|...|:. |.|:|||:|:||||.....||||: 
  Fly     4 YTVLVLLIGIPKLLLQAQMSYEAIFVSVTSEENSKPFDLSNLRLIGRERILNGTFEILEDLDDEH 68

  Fly    69 YEMSNEVLA--LKDGEWESTSVSA-RFKTCKYMAVIYDKYFAVSFK---DSNIPKGTEACPIKKG 127
            :::|.|:..  .:||.::...:|. |...|.:... |..||....|   ::::...|.:|...||
  Fly    69 FQISVEIYTNPARDGNYKLLPMSVPRQGVCTFFKK-YGFYFRDCIKNGINTDLFLNTTSCLFPKG 132

  Fly   128 EYYARNVEVIADNWAHYAKLGLVRSNMLVRKNNVVYGGFDI 168
            .||.:||.:...||....:.||.|......||||..|.:::
  Fly   133 HYYLKNVTINVQNWPKIMQRGLCRHIAFFYKNNVPMGSYNL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA46aNP_001027399.1 DUF1091 88..>154 CDD:301369 20/69 (29%)
CheA86aNP_001027174.1 DUF1091 <126..174 CDD:301369 17/48 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459062
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I7631
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116828at33392
OrthoFinder 1 1.000 - - FOG0009966
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.