powered by:
Protein Alignment CheA46a and CG18539
DIOPT Version :9
Sequence 1: | NP_001027399.1 |
Gene: | CheA46a / 3772338 |
FlyBaseID: | FBgn0262594 |
Length: | 177 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_611315.3 |
Gene: | CG18539 / 37096 |
FlyBaseID: | FBgn0034325 |
Length: | 185 |
Species: | Drosophila melanogaster |
Alignment Length: | 66 |
Identity: | 15/66 - (22%) |
Similarity: | 32/66 - (48%) |
Gaps: | 4/66 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 RAGLECRIESISKV-FGDNETLFEFNFRV--IGR-QRLLNGTLNFHVDLDDDYEMSNEVLALKDG 81
:||.....|.:|.. :..:|:|.:...:: :|| ....:.||:::.|:|.|..:..:|.....|
Fly 20 KAGRNWEYEPLSLTSYSSDESLLKITTKIDRLGRSDYAFSMTLDWNYDVDKDTMVEADVHHCSSG 84
Fly 82 E 82
:
Fly 85 D 85
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CheA46a | NP_001027399.1 |
DUF1091 |
88..>154 |
CDD:301369 |
|
CG18539 | NP_611315.3 |
DUF1091 |
85..162 |
CDD:284008 |
0/1 (0%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45459110 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR21112 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.