DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA46a and CG18537

DIOPT Version :9

Sequence 1:NP_001027399.1 Gene:CheA46a / 3772338 FlyBaseID:FBgn0262594 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_611313.1 Gene:CG18537 / 37094 FlyBaseID:FBgn0034323 Length:188 Species:Drosophila melanogaster


Alignment Length:106 Identity:20/106 - (18%)
Similarity:39/106 - (36%) Gaps:18/106 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NETLFEFNFRVIGRQRLLNGTLNFHVDLDDDYEMSNEVLALKDGEWESTSVSARFKTCKY---MA 99
            :::|.:....::   ||..|.......::.:|:.:.|.:........::...:.:|...:   ..
  Fly    39 DDSLIKLESSIV---RLGRGKFGISARVEWNYDTTEETMVEAVVYRSNSGDESDYKLLPWAIPKQ 100

  Fly   100 VIYDKYFAVSFKD---------SNIP--KGTEACPIKKGEY 129
            ..|| |....:||         ||:|  ||....|..|..|
  Fly   101 TFYD-YLNSYYKDVIMKNFAPCSNVPQFKGKFQPPWPKRTY 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA46aNP_001027399.1 DUF1091 88..>154 CDD:301369 14/56 (25%)
CG18537NP_611313.1 DUF1091 75..163 CDD:284008 14/67 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459112
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.