DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA46a and CG14502

DIOPT Version :9

Sequence 1:NP_001027399.1 Gene:CheA46a / 3772338 FlyBaseID:FBgn0262594 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001163192.1 Gene:CG14502 / 37092 FlyBaseID:FBgn0034321 Length:188 Species:Drosophila melanogaster


Alignment Length:164 Identity:33/164 - (20%)
Similarity:60/164 - (36%) Gaps:30/164 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KVFGDNETLFEFNFRV--IGR-QRLLNGTLNFHVDLDDDYEMSNEVLALKDGEWESTSVSARFKT 94
            :.:..:||..:...:|  :|| :..|:|.:.|....:|:..:  |.:|.:       |.|.....
  Fly    36 ETYTTDETKLKIAAKVERVGRGEYALSGNIEFKYTPEDNTMV--EAMAYR-------STSGDEND 91

  Fly    95 CKYMAVIYDKYFAVSFKD--------------SNIPK--GTEACPIKKGEYYARNVEVIADNWAH 143
            .|.|.....|...|.|.:              ||:.|  |....|..:..|........:|.:..
  Fly    92 YKIMPFSIPKQPYVEFMNSHYKNVVLPNLGDCSNLIKFDGKFEPPWPQDTYVLEKCVANSDGFPD 156

  Fly   144 YAKLGLVRSNMLVRKNNVVYGGFDIVLVLSQKIV 177
            ....|..:.|..:  .|.|..||.:::.::.|:|
  Fly   157 MVPEGYYKVNFTL--TNPVDWGFILIVKITTKLV 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA46aNP_001027399.1 DUF1091 88..>154 CDD:301369 14/81 (17%)
CG14502NP_001163192.1 DUF1091 88..165 CDD:284008 13/76 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459105
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.