DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33890 and HTB1

DIOPT Version :10

Sequence 1:NP_001027330.1 Gene:His2B:CG33890 / 3772336 FlyBaseID:FBgn0053890 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_172258.1 Gene:HTB1 / 837293 AraportID:AT1G07790 Length:148 Species:Arabidopsis thaliana


Alignment Length:235 Identity:53/235 - (22%)
Similarity:75/235 - (31%) Gaps:92/235 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TVFGNLSRCRPSRSEFSKNHLGPLPSFRRLSFADLSRSSSARINEDLAQTLGADLVDFQMCELKM 94
            :..|:||.|..|...|.| ||.  .||.:...:|                        ||.|..:
plant    51 STIGSLSLCDSSLRHFHK-HLE--DSFYKQRVSD------------------------QMGEETL 88

  Fly    95 ITQSFSGN-YLLGEGGFGKVYKGYVDDYLRQSLKAQPVAVKLLDIEGLQGHREWLSEVIFLGQLK 158
            |    ||| :|.|:           ::.:...|:|:.:..|:           |.|.:    ..|
plant    89 I----SGNGFLHGD-----------EEKMNLDLQAKVIEAKV-----------WSSTI----NEK 123

  Fly   159 HPNLVKLIGYCCE--EEERVLIYEFMPRGSLE--------NHL------FRRI------------ 195
            .|.:|........  |.|.:..:|.|.  .||        |||      |.||            
plant   124 IPKIVAKTPIVTPPGEPETINTWELME--GLEDVSPLRSPNHLRSFSFDFVRIQPSHDHDHDVAV 186

  Fly   196 SLSLPWATRLKIAVAAAKGLAFLHDLESPIIYRDFKTSNI 235
            |..|| .:|....|   |....:.||:.|.|...||...:
plant   187 SFDLP-KSRFHENV---KSSCRVDDLDPPDIVSRFKRKTL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33890NP_001027330.1 HFD_H2B 33..120 CDD:467035 21/87 (24%)
HTB1NP_172258.1 valS <1..46 CDD:237855
HFD_H2B 57..146 CDD:467035 29/145 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.