DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33890 and HTB2

DIOPT Version :10

Sequence 1:NP_001027330.1 Gene:His2B:CG33890 / 3772336 FlyBaseID:FBgn0053890 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_197679.1 Gene:HTB2 / 832352 AraportID:AT5G22880 Length:145 Species:Arabidopsis thaliana


Alignment Length:128 Identity:89/128 - (69%)
Similarity:102/128 - (79%) Gaps:7/128 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PPKTSGKAAKKAGKAQKNITKT-----DKKKKRKRK--ESYAIYIYKVLKQVHPDTGISSKAMSI 59
            |......||:|..||.|.:.|.     ||||||.:|  |:|.|||:|||||||||.|||||||.|
plant    18 PAAEPAAAAEKKPKAGKKLPKEPAGAGDKKKKRSKKNVETYKIYIFKVLKQVHPDIGISSKAMGI 82

  Fly    60 MNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 122
            ||||:|||||::|.|:|:||.|||:.|||||||||||||:|||||||||||||||||||:|||
plant    83 MNSFINDIFEKLAGESSKLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33890NP_001027330.1 HFD_H2B 33..120 CDD:467035 71/86 (83%)
HTB2NP_197679.1 HFD_H2B 54..143 CDD:467035 71/88 (81%)

Return to query results.
Submit another query.