DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33928 and CG34260

DIOPT Version :10

Sequence 1:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001262120.1 Gene:CG34260 / 5740551 FlyBaseID:FBgn0085289 Length:178 Species:Drosophila melanogaster


Alignment Length:151 Identity:38/151 - (25%)
Similarity:67/151 - (44%) Gaps:11/151 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IAGVIYFMFF---QMHLVESS-RIEFTNIKCTSMDKKFSDFEYCFLKATNRTYKYLSVKVRLYKI 68
            :|.:.:|:.|   |:.|.::: .|....:.|..:.|.:.:...|.| ...|| ..::||..|.: 
  Fly     2 LARLSFFLIFLPLQLGLAKNNYDIAIKTLGCQIIAKAYVNSLECLL-VRQRT-AVVAVKFSLNQ- 63

  Fly    69 PVHHFTV--NLGLHKRSNGLMPFNQNFTFDGCKMVANV-GNPMVLFLFALFKPYSNINHSCPYTH 130
            .:.||.|  ...|.|:....|.. .:...||||.:.:: .|.:|..||...|..||:..|||.:.
  Fly    64 TIEHFDVLATFDLIKKDKSRMNI-ADIKIDGCKYLGSMYQNNIVGKLFKRLKSVSNLPDSCPVSK 127

  Fly   131 DIIVDKLPTHFVNQQFTKYVP 151
            ..:.:.....|::.:|....|
  Fly   128 GKLYEIRNYTFISDEFPPGAP 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33928NP_001027276.1 DUF1091 81..159 CDD:461928 19/72 (26%)
CG34260NP_001262120.1 DUF1091 73..154 CDD:461928 20/77 (26%)

Return to query results.
Submit another query.