DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33928 and CG14518

DIOPT Version :9

Sequence 1:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:184 Identity:57/184 - (30%)
Similarity:87/184 - (47%) Gaps:36/184 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FQCITIAGVIYFMFFQMHLVESSRIEFTNIKCTSMDKKFSDFEYCFLKATNRTYKYLSVKVRLYK 67
            :||..:       .|:|          ||..|.:.:|.:.:|..|.|:|.:|....|:|...|..
  Fly    18 YQCDAV-------IFKM----------TNAVCETYNKSWVEFGLCRLRAVSRNKVCLNVDANLLH 65

  Fly    68 IPVHHFTVNLGLHKRSNGLMPFNQNFTFDGCKMVANVGNPMVLFLFALFKPYSNINHSCPY---- 128
             |||...|...|.||:||..|:..:.:||||:.:....|.::..::.|||.||.|||:|||    
  Fly    66 -PVHDVIVKARLLKRANGYKPWLYSVSFDGCQFIRRRNNALIRIVWELFKEYSTINHTCPYVGLQ 129

  Fly   129 ---THDIIVDKLPTHFVNQQFTKYVPLPEGDYVFNSNWFTNGKNRAIVRVHFSF 179
               ...:..:||||           |:|.|:|:...:|..|.|.:|...|:|:|
  Fly   130 QVKNFYLRSEKLPT-----------PIPTGEYLLMIDWVFNKKPQAATNVYFTF 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33928NP_001027276.1 DUF1091 75..159 CDD:284008 31/90 (34%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 32/101 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472322
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.