DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33928 and CG12849

DIOPT Version :9

Sequence 1:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_611969.2 Gene:CG12849 / 37971 FlyBaseID:FBgn0035068 Length:172 Species:Drosophila melanogaster


Alignment Length:166 Identity:61/166 - (36%)
Similarity:97/166 - (58%) Gaps:2/166 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YFMFFQMHLVESSRIEFTNIKCTSMDKKFSDFEYCFLKATNRTYKYLSVKVRLYKIPVHHFTVNL 77
            :.:.|...:......||.|:.|...|:.|.|||||:||:.||||||||:|.:::::||.:.....
  Fly     7 FLLIFMSPMAIRGHFEFNNVVCLVRDRMFMDFEYCYLKSVNRTYKYLSLKTKMFRLPVDNCETRF 71

  Fly    78 GLHKRSNGLMPFNQNFTFDGCKMVANVGNPMVLFLFALFKPYSNINHSCPYTHDIIVDKLPTHFV 142
            .|..|.|..:.:|.:|..|.||.:.:..:.:..:::..|.||||:||:|||.|||::||||...:
  Fly    72 QLRMRENRRVLYNFDFKVDSCKFMRDRKHVIANWVYQTFGPYSNLNHTCPYDHDIVLDKLPVQHL 136

  Fly   143 NQQFTKYVPLPEGDYVFNSNWFTNGKNRAIVRVHFS 178
            |:.....:  |:|.|:.||.|...|..|..|.::|:
  Fly   137 NKLVQSII--PDGRYMMNSTWMVAGIPRTDVILYFT 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33928NP_001027276.1 DUF1091 75..159 CDD:284008 29/83 (35%)
CG12849NP_611969.2 DM8 80..172 CDD:214778 33/93 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471991
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
55.030

Return to query results.
Submit another query.