DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33928 and CG13561

DIOPT Version :9

Sequence 1:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster


Alignment Length:173 Identity:43/173 - (24%)
Similarity:87/173 - (50%) Gaps:10/173 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IYFMFFQMHLVESSRI-EFTNIKCTSMDKKFSDFEYCFLKATNRTYKYLSVKVRLYKIPVHHFTV 75
            ::.:|...|:::...: :||||:|.|.|:.|:....|.|.|..|....:|::..:.:.|....::
  Fly     7 LFLLFGLWHILQVQGVAKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWPKGPVSM 71

  Fly    76 NLGLHKRSNGLMPFNQNF-TFDGCKMVANVGNPMVLFLFALFKPYSNINHSCPYTHDIIVD--KL 137
            .:.|.|:::|..||..|. ..|.|:.:....:|.:..:.:.|...:|:| .||...:|:::  :.
  Fly    72 RMQLLKKASGYKPFLYNICQSDVCEYLEKRNHPFINIILSSFGNRTNVN-KCPIPPEIVLEHFRF 135

  Fly   138 PTHFVNQQFTKYVPLPEGDYVFNSNWFTNGKNRAIVRVHFSFT 180
            |...::.     :|||.|||...:.:..:....|.|:|:|:.|
  Fly   136 PVKVLDM-----MPLPFGDYGLFTTFTFHRSELAQVKVYFTLT 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33928NP_001027276.1 DUF1091 75..159 CDD:284008 22/86 (26%)
CG13561NP_611830.3 DM8 82..173 CDD:214778 23/96 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472321
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.