DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33928 and CG33679

DIOPT Version :10

Sequence 1:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027273.1 Gene:CG33679 / 3772494 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster


Alignment Length:175 Identity:53/175 - (30%)
Similarity:83/175 - (47%) Gaps:19/175 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YFMFFQMHLVESSR--IEFTNIKCTSMDKKFSDFEYCFLKATNRTYKYLSVKVRLYKIPVHHFTV 75
            |.::..:..:..|.  :..||:||.|.||.|..|..|.||...|.....::.|:|.|:|::...|
  Fly     3 YLLWISLLFIGESHGYVRLTNLKCESYDKSFVVFPECRLKVLGRGIIGANIHVKLLKLPINRMVV 67

  Fly    76 NLGLHKRSNGLMPFNQNFTFDGCKMVANVGNPMVLFLF-ALFKPYSNINHSCPYTHDIIVDKLPT 139
            ....:::.||..||..|.:.:.|:::.......|.:.| ..|.|:|||||:|||..||.:.....
  Fly    68 RFITYRKLNGYHPFLFNVSEEHCRVLRYPNRLRVFYYFYTAFMPFSNINHTCPYNDDIYIRNCTL 132

  Fly   140 HFVNQQFTKYVPLPEGDYVFN-------SNWFTNGKNRAIVRVHF 177
            .  ::.|.| ||||:|.|...       .||.      :|:.:||
  Fly   133 D--DRMFAK-VPLPKGSYKLTLEMDDGVVNWI------SIINIHF 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33928NP_001027276.1 DUF1091 81..159 CDD:461928 28/78 (36%)
CG33679NP_001027273.1 DUF1091 70..149 CDD:461928 28/81 (35%)

Return to query results.
Submit another query.