DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33928 and CG33687

DIOPT Version :9

Sequence 1:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027130.2 Gene:CG33687 / 3772322 FlyBaseID:FBgn0053687 Length:169 Species:Drosophila melanogaster


Alignment Length:164 Identity:58/164 - (35%)
Similarity:102/164 - (62%) Gaps:3/164 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FQMHLVESSRIEFTNIKCTSMDKKFSDFEYCFLKATNRTYKYLSVKVRLYKIPVHHFTVNLGLHK 81
            ::::::.:|.:.|||:||..:|:.|.:||.|.:||.|||:||:.:.::||.:|:::..:.|...:
  Fly     2 WRINVILTSHLSFTNLKCEMIDRTFGNFEMCRIKAVNRTHKYIDINLKLYILPINNIMIKLDSKR 66

  Fly    82 RSNGLMPFNQNFTFDGCKMVANVGNPMVLFLFALFKPY---SNINHSCPYTHDIIVDKLPTHFVN 143
            .:||..||..:.|||.||.:.|.....::||..:...:   ||:||:|||.:||.|:|..|..:.
  Fly    67 YTNGYRPFFMSLTFDFCKYLKNPNQRSMIFLKEIHSTFINASNLNHTCPYNNDITVNKFWTGNLE 131

  Fly   144 QQFTKYVPLPEGDYVFNSNWFTNGKNRAIVRVHF 177
            :.|.:|:|:|.|||...|.|:::...|.:|...|
  Fly   132 RAFLRYLPVPNGDYAIFSTWYSSNVPRLLVNTFF 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33928NP_001027276.1 DUF1091 75..159 CDD:284008 32/86 (37%)
CG33687NP_001027130.2 DUF1091 64..147 CDD:284008 31/82 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
55.010

Return to query results.
Submit another query.