DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33928 and CG33626

DIOPT Version :10

Sequence 1:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027405.2 Gene:CG33626 / 3772257 FlyBaseID:FBgn0053626 Length:167 Species:Drosophila melanogaster


Alignment Length:139 Identity:36/139 - (25%)
Similarity:61/139 - (43%) Gaps:15/139 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VIYFMFFQMHLVESS-RIEFTNIKCTSMDKKFSDFEYCFLKATNRTYKYLSVKV--RLYKIPVHH 72
            :|..:....|..|:. |:.:....| .|...::|...|.:..|.|:...:.:|:  .|.:|.|: 
  Fly     1 MILILIHVFHYTEAKRRLRWDCFDC-QMGPHYADQMTCQIGGTRRSLLNVELKLLTELDQIKVY- 63

  Fly    73 FTVNLGLHKRSNGLMPFNQNFTFDGCKMVAN-VGNPMVLFLFALFKPYSNINHSCP------YTH 130
              :.:....:|..|.....:.|||||::::: |...||..:|......||....||      |.|
  Fly    64 --IKISTRFKSTTLYRKFFDITFDGCRVISDMVQGTMVSNMFNAVVKSSNQPRKCPVNKGTIYYH 126

  Fly   131 DI-IVDKLP 138
            :| |.|.||
  Fly   127 NISIEDALP 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33928NP_001027276.1 DUF1091 81..159 CDD:461928 22/66 (33%)
CG33626NP_001027405.2 DUF1091 76..153 CDD:472716 20/60 (33%)

Return to query results.
Submit another query.