DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33928 and CG33770

DIOPT Version :10

Sequence 1:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027144.2 Gene:CG33770 / 3772256 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster


Alignment Length:146 Identity:36/146 - (24%)
Similarity:53/146 - (36%) Gaps:34/146 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KKFSDFEYCFLKATNRTYK-YLSVKVRLYKIPVHHFTVNLGLHKRSNGLMPFNQNF--TFDGCKM 100
            |.|.:|.:     |.|..| :|.:.:|  |..|..:...|....|......|...|  :.|.|  
  Fly    44 KYFENFTF-----TIRNDKIFLDMYLR--KPLVRGWRARLDFRTRVGNSKSFQSLFSTSIDVC-- 99

  Fly   101 VANVGNPMVLFLFA-----LFKPYSNINHSCPYTHDIIVDKLPTHFV--NQQFTK-YVP--LPEG 155
              |:.|...:.||.     |.| |.|....||..        .:|:.  :.||.: .||  :..|
  Fly   100 --NIVNAAKINLFKKWYKNLLK-YGNFLRQCPLN--------ASHYYLRDWQFGEGLVPPFITSG 153

  Fly   156 DYVFNS-NWFTNGKNR 170
            .|...: |:|...|.:
  Fly   154 SYRLETYNFFGKYKGK 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33928NP_001027276.1 DUF1091 81..159 CDD:461928 22/89 (25%)
CG33770NP_001027144.2 DM8 88..178 CDD:214778 24/95 (25%)

Return to query results.
Submit another query.