DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33928 and CG33648

DIOPT Version :10

Sequence 1:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027265.2 Gene:CG33648 / 3772188 FlyBaseID:FBgn0053648 Length:178 Species:Drosophila melanogaster


Alignment Length:158 Identity:67/158 - (42%)
Similarity:100/158 - (63%) Gaps:2/158 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SRIEFTNIKCTSMDKKFSDFEYCFLKATNRTYKYLSVKVRLYKIPVHHFTVNLGLHKRSNGLMPF 89
            |.:|||||||:|.|..:..:|.|.:|:.||||||:||..||..:|:.:.|:|:.|:||.||..||
  Fly    21 SIVEFTNIKCSSSDTSYVYYESCRIKSVNRTYKYISVNSRLLILPLTNATINVALYKRYNGYKPF 85

  Fly    90 NQNFTFDGCKMV-ANVGNPMVLFLFALFKPYSNI-NHSCPYTHDIIVDKLPTHFVNQQFTKYVPL 152
            ..|.:.|.|:.: ....|.:|.:||.|....||| :.:||:...|.||||.|:|:|.:.|:.:|:
  Fly    86 LYNVSVDACRFLRTQKSNIVVKYLFDLILLKSNIRSPTCPFNSFISVDKLTTNFLNNKLTQVLPV 150

  Fly   153 PEGDYVFNSNWFTNGKNRAIVRVHFSFT 180
            |||||:|...||:....|:.|.|:.:.:
  Fly   151 PEGDYLFAFRWFSYNIYRSSVNVYITIS 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33928NP_001027276.1 DUF1091 81..159 CDD:461928 34/79 (43%)
CG33648NP_001027265.2 DUF1091 71..157 CDD:461928 36/85 (42%)

Return to query results.
Submit another query.