DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33928 and CG33775

DIOPT Version :10

Sequence 1:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027410.1 Gene:CG33775 / 3772054 FlyBaseID:FBgn0053775 Length:182 Species:Drosophila melanogaster


Alignment Length:137 Identity:48/137 - (35%)
Similarity:75/137 - (54%) Gaps:10/137 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SRIEFTNIKCTSMDKKFSDFEYCFLKATNRTYKYLSVKVRLYKIPVHHFTVNLGLHKRSNGLMPF 89
            |:..|.|::|.|.::.::.||.|.|....|......:.::|::.||.:..:|..:::|.||..||
  Fly    28 SKSRFINMQCESYNESYAVFEKCKLNLLGRGRVGADMYLKLFQTPVENCWINWAMYRRYNGFQPF 92

  Fly    90 NQNFTFDGCKMVANVGNPMVLFLFAL----FKPYSNINHSCPYTHDIIVDKLPTHFVNQQFTKYV 150
            ..|.:.|.|::   :|||..:....|    .|..||:||||||.||||||.:.   .:..|.|.:
  Fly    93 LYNVSTDLCQL---LGNPNAISFQGLVINAIKKGSNLNHSCPYNHDIIVDNME---FSDDFLKTL 151

  Fly   151 PLPEGDY 157
            |||:|.|
  Fly   152 PLPQGVY 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33928NP_001027276.1 DUF1091 81..159 CDD:461928 34/81 (42%)
CG33775NP_001027410.1 DUF1091 78..160 CDD:461928 35/87 (40%)

Return to query results.
Submit another query.