DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33928 and CG33796

DIOPT Version :9

Sequence 1:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster


Alignment Length:175 Identity:55/175 - (31%)
Similarity:78/175 - (44%) Gaps:31/175 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 MHLVESSRIEF--TNIKCTSMDKKFSDFEYCFLKATNR---------TYKYLSVKVRLYKIPVHH 72
            |.|..|:.:.|  ||:.|.|.:|.:.....|.|||.||         |:.|          |...
  Fly    17 MILKPSNPVVFKLTNVHCGSYNKTWIRINQCRLKAINRHRTVFNFNATFLY----------PTKS 71

  Fly    73 FTVNLGLHKRSNGLMPFNQNFTFDGCKMVANVGNPMVLFLFALFKPYSNINHSCPYTHDIIVDKL 137
            .||:....||.||..|:..|...|||:.:....:.:.:.||.:::.::||||:||...|:||.  
  Fly    72 ITVHYQTFKRENGYRPWLVNTQIDGCRFLRKPYDALGILLFNIYRNFTNINHTCPLQGDMIVR-- 134

  Fly   138 PTHFVNQQFTKYV---PLPEGDYVFNSNWFTNGKNRAIVRVHFSF 179
                 |...|..|   |||.|||:...:|...||.:....|.|.|
  Fly   135 -----NMYLTTDVMRLPLPTGDYLLAIDWIFYGKPQFATNVSFQF 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33928NP_001027276.1 DUF1091 75..159 CDD:284008 30/86 (35%)
CG33796NP_001027128.1 DUF1091 74..154 CDD:284008 30/86 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472314
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.