DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33928 and CG33796

DIOPT Version :10

Sequence 1:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster


Alignment Length:175 Identity:55/175 - (31%)
Similarity:78/175 - (44%) Gaps:31/175 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 MHLVESSRIEF--TNIKCTSMDKKFSDFEYCFLKATNR---------TYKYLSVKVRLYKIPVHH 72
            |.|..|:.:.|  ||:.|.|.:|.:.....|.|||.||         |:.|          |...
  Fly    17 MILKPSNPVVFKLTNVHCGSYNKTWIRINQCRLKAINRHRTVFNFNATFLY----------PTKS 71

  Fly    73 FTVNLGLHKRSNGLMPFNQNFTFDGCKMVANVGNPMVLFLFALFKPYSNINHSCPYTHDIIVDKL 137
            .||:....||.||..|:..|...|||:.:....:.:.:.||.:::.::||||:||...|:||.  
  Fly    72 ITVHYQTFKRENGYRPWLVNTQIDGCRFLRKPYDALGILLFNIYRNFTNINHTCPLQGDMIVR-- 134

  Fly   138 PTHFVNQQFTKYV---PLPEGDYVFNSNWFTNGKNRAIVRVHFSF 179
                 |...|..|   |||.|||:...:|...||.:....|.|.|
  Fly   135 -----NMYLTTDVMRLPLPTGDYLLAIDWIFYGKPQFATNVSFQF 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33928NP_001027276.1 DUF1091 81..159 CDD:461928 29/80 (36%)
CG33796NP_001027128.1 DUF1091 74..154 CDD:461928 30/86 (35%)

Return to query results.
Submit another query.