DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33928 and CG33927

DIOPT Version :9

Sequence 1:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster


Alignment Length:178 Identity:55/178 - (30%)
Similarity:92/178 - (51%) Gaps:10/178 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TIAGVIYF-MFFQMHL----VESSRIEFTNIKCTSMDKKFSDFEYCFLKATNRTYKYLSVKVRLY 66
            |::.|:|. :||::.|    :.:||.:|||..|.|:::.:.....|.|||..|....||....:.
  Fly     3 TVSNVLYLVLFFRIALELGSINASRFKFTNFVCDSVNETWLAVHQCRLKAIRRGTTTLSFNGTVL 67

  Fly    67 KIPVHHFTVNLGLHKRSNGLMPFNQNFTFDGCKMVANVGNPMVLFLFALFKPYSNINHSCPYTHD 131
            | .:..|.|:..:.||:||..|:..|.|||||:.:.......|:.:|.|.|.:||:|.:|||...
  Fly    68 K-TISKFRVHGQIFKRANGFKPWLYNITFDGCRFLRKPYEAPVIIVFNLLKSFSNLNFTCPYMGP 131

  Fly   132 IIVDKLPTHFVNQQFTKYVPLPEGDYVFNSNWFTNGKNRAIVRVHFSF 179
            :.:  :..|.:.:|..  ||||.|:|:....|:.:........:.|:|
  Fly   132 VHI--MGLHIIGEQIP--VPLPTGEYLIQIKWYISKTLFLSTGIKFAF 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33928NP_001027276.1 DUF1091 75..159 CDD:284008 30/83 (36%)
CG33927NP_001027147.1 DUF1091 75..155 CDD:284008 30/83 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472317
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.