DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33928 and CG33768

DIOPT Version :10

Sequence 1:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027142.2 Gene:CG33768 / 3771840 FlyBaseID:FBgn0053768 Length:175 Species:Drosophila melanogaster


Alignment Length:104 Identity:23/104 - (22%)
Similarity:44/104 - (42%) Gaps:20/104 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FQCITIAGVIYFMFFQMHLVESSRIEF---TNIKC-TSMDKKF-----SDFEYCFLKAT------ 52
            |..:.:..|...::..:.|:::.:..|   .:::. .|..|||     :|.:||.|.:|      
  Fly    35 FATLNVTSVNSTIYADIELLQALKAGFRGHVDVQLRLSNAKKFQSLVQADTDYCELLSTLKDSLF 99

  Fly    53 NRTYKYLSVKVRLYK---IPVHHFTVNLGLHKRSNGLMP 88
            .|..|.:|......:   :|..|:.:. |.|... ||:|
  Fly   100 RRWIKSVSKNSNFMENCPVPAGHYYLK-GWHVEM-GLVP 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33928NP_001027276.1 DUF1091 81..159 CDD:461928 3/8 (38%)
CG33768NP_001027142.2 DM8 76..167 CDD:214778 17/63 (27%)

Return to query results.
Submit another query.