DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33928 and CG33654

DIOPT Version :9

Sequence 1:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster


Alignment Length:171 Identity:71/171 - (41%)
Similarity:106/171 - (61%) Gaps:13/171 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VIYFMFFQMHLVESSRIEFTNIKCTSMDKKFSDFEYCFLKATNRTYKYLSVKVRLYKIPVHHFTV 75
            |:..:...|....||:.||||::|||.||.|.|||||::::.||:||||::||.|:|.|      
  Fly    10 VVILVILLMAKWASSKFEFTNLQCTSFDKSFDDFEYCYIRSANRSYKYLTLKVNLFKTP------ 68

  Fly    76 NLGLHKRSNGLMPFNQNFTFDGCKMVANV-GNPMVLFLFALFKPYSNINHSCPYTHDIIVDKLPT 139
                  |.||..||..|.|.|.|:.:.|. ..|:..:.:..|..|||:|||||:.||:||||:|.
  Fly    69 ------RFNGYRPFMFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFNHDLIVDKIPI 127

  Fly   140 HFVNQQFTKYVPLPEGDYVFNSNWFTNGKNRAIVRVHFSFT 180
            .|||.:.|..:|.|||||:..::|.....:||:|:::::.:
  Fly   128 DFVNHRVTNILPFPEGDYLLETHWIAYEIDRAMVKIYYTIS 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33928NP_001027276.1 DUF1091 75..159 CDD:284008 37/84 (44%)
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 42/98 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471992
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.