DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33928 and CG33631

DIOPT Version :10

Sequence 1:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027167.1 Gene:CG33631 / 3771784 FlyBaseID:FBgn0053631 Length:195 Species:Drosophila melanogaster


Alignment Length:41 Identity:13/41 - (31%)
Similarity:18/41 - (43%) Gaps:7/41 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FTNIKCTSMDKKF-------SDFEYCFLKATNRTYKYLSVK 62
            ||..:...|.|.|       ||...|.::..|.:.|.:|||
  Fly   113 FTEFRKNPMMKYFLQSEMQLSDIIVCPVRVGNYSVKNVSVK 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33928NP_001027276.1 DUF1091 81..159 CDD:461928
CG33631NP_001027167.1 DUF1091 84..167 CDD:461928 13/41 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.