DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33928 and CG33642

DIOPT Version :10

Sequence 1:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027257.1 Gene:CG33642 / 3771733 FlyBaseID:FBgn0053642 Length:187 Species:Drosophila melanogaster


Alignment Length:168 Identity:36/168 - (21%)
Similarity:64/168 - (38%) Gaps:28/168 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FTN---IKC--TSMDKKFSDF-------------EYCFLKATNRTY--KYLSVKVRLYKIPVHHF 73
            |||   :||  .|...|.::|             ::..:...||:|  ..:.||..:..|.:|  
  Fly    15 FTNHICLKCEERSFRIKMNEFAVKYKMRDLIQHIDFRIVNLNNRSYVNGEMIVKSDVEDILMH-- 77

  Fly    74 TVNLGLHKRSNGLMPFNQNFTFDGCKMV-ANVGNPMVLFLFALFKPYSNINHSCPYTHDIIVDKL 137
             ..:...|.||.......:...|.|:.: .:..|.:.......||.:.:.|.|||...:......
  Fly    78 -TTMDFWKTSNQKKIKLYDGRLDACQFLKTSHRNGLFKIYVKSFKKHIHGNLSCPLRTNFNYTLT 141

  Fly   138 PTHFVNQQFTKYVPLPEGDYVFNSNWFTNGKNRAIVRV 175
            ..|...:....:|||  |.:...:.:||  ::|..:|:
  Fly   142 NWHMDEKDLPPFVPL--GTFRTVTEYFT--QDRLALRI 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33928NP_001027276.1 DUF1091 81..159 CDD:461928 17/78 (22%)
CG33642NP_001027257.1 DUF1091 79..160 CDD:461928 17/82 (21%)

Return to query results.
Submit another query.