DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33928 and CG13193

DIOPT Version :9

Sequence 1:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster


Alignment Length:162 Identity:37/162 - (22%)
Similarity:70/162 - (43%) Gaps:38/162 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIEFTNI--KCTSMDKKFSDFEYC-----FLKATNRTYKYLSVKVRLYKIPVHHFTVNLGLHKRS 83
            |.:||||  :|:.        :||     :|.|...    |::.:.|.:...:.....:.|.:..
  Fly    34 RSKFTNISVECSK--------DYCSSIRGWLTAKGE----LNLDIHLNRTLKNGLRTTITLLQLI 86

  Fly    84 NGLMPFNQNFTF--DGCKMVANV--GNPMVLFLFALFKPYSNINHSCPY---THDIIVDKLPTHF 141
            :|...:...|::  |.||.:..:  .:.|.::|..:|| |.|:...||.   ::|:...:|..| 
  Fly    87 DGKDRYQTLFSYDMDTCKTLRELLQSSLMKVWLRNVFK-YGNLADRCPIQPASYDVRNFQLENH- 149

  Fly   142 VNQQFTKYVP--LPEGDY-VFNSNWFTNGKNR 170
                   .:|  ||.|.| :.::|::...|.|
  Fly   150 -------SIPGYLPAGFYRLHDTNYYGKPKGR 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33928NP_001027276.1 DUF1091 75..159 CDD:284008 22/93 (24%)
CG13193NP_610699.1 DM8 91..183 CDD:214778 23/93 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447854
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.