DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33928 and CG12898

DIOPT Version :10

Sequence 1:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_610581.1 Gene:CG12898 / 36096 FlyBaseID:FBgn0033516 Length:156 Species:Drosophila melanogaster


Alignment Length:151 Identity:38/151 - (25%)
Similarity:61/151 - (40%) Gaps:49/151 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 AVRSCRNRSA-----RKRTHQIPDHKRLQR-ELTR-------EIRGRN---QFEHTRLNESPVFA 399
            |:.|.|..||     :||.      |.:|: ||.|       .|||::   :.|.:|.:...|.|
  Fly     4 ALHSIRGFSASTVCKKKRI------KNVQKLELVRLMKANFLFIRGKHAIPRSEKSRADVWKVIA 62

  Fly   400 RNDRFPASSAPLQ--DEIYRNHEHTRQFLVNLFSKRQHRYVRSNSQLANINNRYIPPTQTRDEPR 462
              .|..:...|:|  :...|.....|....:..:|.|: |||.:.:               |.|.
  Fly    63 --GRLNSLGPPVQSAEAWQRRWNDMRSATKSKMAKIQN-YVREHGE---------------DCPY 109

  Fly   463 EAVNVVQRVASDAEPLWEQYS 483
            | :|:|:|:      :||.:|
  Fly   110 E-LNLVERL------IWETFS 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33928NP_001027276.1 DUF1091 81..159 CDD:461928
CG12898NP_610581.1 DUF1091 58..129 CDD:461928 21/91 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.