DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33928 and CG33453

DIOPT Version :10

Sequence 1:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_995888.1 Gene:CG33453 / 2768851 FlyBaseID:FBgn0053453 Length:175 Species:Drosophila melanogaster


Alignment Length:175 Identity:52/175 - (29%)
Similarity:89/175 - (50%) Gaps:9/175 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ITIAGVIYFMFFQMHLV-ESSRIEFTNIKCTSMDKKFSDFEYCFLKATNRTYKYLSVKVRLYKIP 69
            :.:.||.....|.:..| |:..|:.||:.|.|::|.::.|.||.|||.:|....|::.. .:..|
  Fly     5 VILPGVFLAALFLISSVSEAPNIKLTNVVCESINKSWAVFHYCRLKAYSRNKTSLNINA-TFLHP 68

  Fly    70 VHHFTVNLGLHKRSNGLMPFNQNFTFDGCKMVANVGNPMVLFLFALFKPYSNINHSCPYTHDIIV 134
            .::.::.|.:.||.:|..||..:.|.|.|:.:....||::...::..|.||.:||:|||...::.
  Fly    69 TNNVSLRLKMVKRLSGYKPFLFDVTIDACQFLRKRHNPVIKMFYSFIKDYSTLNHTCPYGLQVVS 133

  Fly   135 DKLPTHFVNQQFTKYVPLPEGDYVFNSNWFTNGKNRAIVRVHFSF 179
            |.....|.       ||||.|||....::....|.:..|.::|:|
  Fly   134 DYHTAVFP-------VPLPSGDYGVLLDFIFYAKKQFHVNIYFNF 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33928NP_001027276.1 DUF1091 81..159 CDD:461928 27/77 (35%)
CG33453NP_995888.1 DUF1091 78..149 CDD:461928 25/77 (32%)

Return to query results.
Submit another query.