DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33928 and CG33463

DIOPT Version :9

Sequence 1:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_995846.2 Gene:CG33463 / 2768844 FlyBaseID:FBgn0053463 Length:180 Species:Drosophila melanogaster


Alignment Length:175 Identity:80/175 - (45%)
Similarity:113/175 - (64%) Gaps:3/175 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TIAGVIYFMFFQMHLVE--SSRIEFTNIKCTSMDKKFSDFEYCFLKATNRTYKYLSVKVRLYKIP 69
            |...::..::..|.|..  ::.:||.||.|.::||:||:||||:||:.||||||:|||::|.::|
  Fly     3 TKLSLLLTLWLAMQLASKTTAMLEFKNINCEAVDKEFSEFEYCYLKSVNRTYKYISVKLKLLQLP 67

  Fly    70 VHHFTVNLGLHKRSNGLMPFNQNFTFDGCKMVANVG-NPMVLFLFALFKPYSNINHSCPYTHDII 133
            |.:..||..|.:|.||..||..|.|.|.||:|.|.. :|:..:.|..||.:||:|||||:.||||
  Fly    68 VTNAKVNGALFQRHNGYKPFLYNITVDCCKLVKNPKYSPVASYFFDTFKEFSNMNHSCPFNHDII 132

  Fly   134 VDKLPTHFVNQQFTKYVPLPEGDYVFNSNWFTNGKNRAIVRVHFS 178
            :|||....|..:.|..:|.|||||:...||||:|..|.|.:|..|
  Fly   133 LDKLTAKSVYHRMTNILPFPEGDYMLQLNWFTSGIYRVIFKVFVS 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33928NP_001027276.1 DUF1091 75..159 CDD:284008 41/84 (49%)
CG33463NP_995846.2 DUF1091 73..158 CDD:399471 41/84 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472015
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.