DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33928 and CG33483

DIOPT Version :9

Sequence 1:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster


Alignment Length:151 Identity:80/151 - (52%)
Similarity:107/151 - (70%) Gaps:1/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SSRIEFTNIKCTSMDKKFSDFEYCFLKATNRTYKYLSVKVRLYKIPVHHFTVNLGLHKRSNGLMP 88
            :|.:|||||||||.||.|.|||||.||:.||::||||:||.|:|:|:....||..|.||.||..|
  Fly    72 ASLVEFTNIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLKVNLHKVPITKVKVNFSLLKRFNGYKP 136

  Fly    89 FNQNFTFDGCKMVANVG-NPMVLFLFALFKPYSNINHSCPYTHDIIVDKLPTHFVNQQFTKYVPL 152
            |..|.|.|.||.:.:.. ||:..|.:.|||.:||:||:||:.||:||:||||:|:||:....:..
  Fly   137 FLYNITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPFDHDLIVEKLPTNFMNQKVNGDIKF 201

  Fly   153 PEGDYVFNSNWFTNGKNRAIV 173
            |.|||:|:|:|:..|.|||.|
  Fly   202 PHGDYLFHSDWYAYGINRATV 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33928NP_001027276.1 DUF1091 75..159 CDD:284008 41/84 (49%)
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 41/84 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472089
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.