DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33928 and CG33483

DIOPT Version :10

Sequence 1:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster


Alignment Length:151 Identity:80/151 - (52%)
Similarity:107/151 - (70%) Gaps:1/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SSRIEFTNIKCTSMDKKFSDFEYCFLKATNRTYKYLSVKVRLYKIPVHHFTVNLGLHKRSNGLMP 88
            :|.:|||||||||.||.|.|||||.||:.||::||||:||.|:|:|:....||..|.||.||..|
  Fly    72 ASLVEFTNIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLKVNLHKVPITKVKVNFSLLKRFNGYKP 136

  Fly    89 FNQNFTFDGCKMVANVG-NPMVLFLFALFKPYSNINHSCPYTHDIIVDKLPTHFVNQQFTKYVPL 152
            |..|.|.|.||.:.:.. ||:..|.:.|||.:||:||:||:.||:||:||||:|:||:....:..
  Fly   137 FLYNITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPFDHDLIVEKLPTNFMNQKVNGDIKF 201

  Fly   153 PEGDYVFNSNWFTNGKNRAIV 173
            |.|||:|:|:|:..|.|||.|
  Fly   202 PHGDYLFHSDWYAYGINRATV 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33928NP_001027276.1 DUF1091 81..159 CDD:461928 38/78 (49%)
CG33483NP_001189327.1 DUF1091 123..208 CDD:461928 41/84 (49%)

Return to query results.
Submit another query.