DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chrac-14 and NF-YB4

DIOPT Version :9

Sequence 1:NP_476646.2 Gene:Chrac-14 / 3772329 FlyBaseID:FBgn0043002 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_172377.1 Gene:NF-YB4 / 837424 AraportID:AT1G09030 Length:139 Species:Arabidopsis thaliana


Alignment Length:111 Identity:37/111 - (33%)
Similarity:61/111 - (54%) Gaps:0/111 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTSSSTALAHKQNHKTITAKDIL 70
            ||..||.|.:|||:|:.||.:|.:||||:..:...|:.|..|||..::...|::|.||:...||.
plant     4 EDRLLPIANVGRLMKQILPSNAKISKEAKQTVQECATEFISFVTCEASEKCHRENRKTVNGDDIW 68

  Fly    71 QTLTELDFESFVPSLTQDLEVYRKVVKEKKESKASKKDSNTAENAN 116
            ..|:.|..:::..::.:.|..||:..:|:.|......||...:..|
plant    69 WALSTLGLDNYADAVGRHLHKYREAERERTEHNKGSNDSGNEKETN 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chrac-14NP_476646.2 H4 6..>93 CDD:390056 30/86 (35%)
NF-YB4NP_172377.1 CBFD_NFYB_HMF 6..71 CDD:395650 25/64 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103217
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.