DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chrac-14 and NF-YB3

DIOPT Version :9

Sequence 1:NP_476646.2 Gene:Chrac-14 / 3772329 FlyBaseID:FBgn0043002 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_193190.1 Gene:NF-YB3 / 827101 AraportID:AT4G14540 Length:161 Species:Arabidopsis thaliana


Alignment Length:105 Identity:36/105 - (34%)
Similarity:58/105 - (55%) Gaps:0/105 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTSSSTALAHKQNHKTITAKD 68
            |.:|..||.|.:.|::|:|||.:|.:||:|:..:....|.|..|:|..::....::..|||...|
plant    20 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDD 84

  Fly    69 ILQTLTELDFESFVPSLTQDLEVYRKVVKEKKESKASKKD 108
            :|..:|.|.||.:|..|...|:.||:|..||..:...:.|
plant    85 LLWAMTTLGFEDYVEPLKVYLQKYREVEGEKTTTAGRQGD 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chrac-14NP_476646.2 H4 6..>93 CDD:390056 29/86 (34%)
NF-YB3NP_193190.1 CBFD_NFYB_HMF 24..89 CDD:395650 21/64 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.