DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chrac-14 and Pole3

DIOPT Version :9

Sequence 1:NP_476646.2 Gene:Chrac-14 / 3772329 FlyBaseID:FBgn0043002 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_067473.2 Gene:Pole3 / 59001 MGIID:1933378 Length:145 Species:Mus musculus


Alignment Length:129 Identity:61/129 - (47%)
Similarity:84/129 - (65%) Gaps:1/129 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTSSSTALAHKQNHKTIT 65
            |.||.||||||||||.|:||||||:..::|||||:||:||||||.::.||.:...|.|...||:.
Mouse     1 MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLN 65

  Fly    66 AKDILQTLTELDFESFVPSLTQDLEVYRKVVKEKKE-SKASKKDSNTAENANASATATAEEAPE 128
            |.|:|..:.|::|:.|:..|.:.||.||:..|.||| |:..|||.:..::.....:...||..|
Mouse    66 ASDVLSAMEEMEFQRFITPLKEALEAYRREQKGKKEASEQKKKDKDKKDSEEQDKSREEEEEDE 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chrac-14NP_476646.2 H4 6..>93 CDD:390056 45/86 (52%)
Pole3NP_067473.2 H4 1..>105 CDD:304892 55/103 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I9172
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9694
Inparanoid 1 1.050 116 1.000 Inparanoid score I4810
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55153
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004234
OrthoInspector 1 1.000 - - oto94853
orthoMCL 1 0.900 - - OOG6_103217
Panther 1 1.100 - - LDO PTHR46172
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5309
SonicParanoid 1 1.000 - - X4036
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.000

Return to query results.
Submit another query.