DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chrac-14 and pole3

DIOPT Version :9

Sequence 1:NP_476646.2 Gene:Chrac-14 / 3772329 FlyBaseID:FBgn0043002 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001017264.1 Gene:pole3 / 550018 XenbaseID:XB-GENE-6455325 Length:147 Species:Xenopus tropicalis


Alignment Length:128 Identity:60/128 - (46%)
Similarity:82/128 - (64%) Gaps:0/128 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTSSSTALAHKQNHKTIT 65
            |.||.|||||||||:.|:|||||||..::|||||:||:||||||.::.||.:...|.|...||:.
 Frog     1 MAERPEDLNLPNAVVTRIIKEALPEGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLN 65

  Fly    66 AKDILQTLTELDFESFVPSLTQDLEVYRKVVKEKKESKASKKDSNTAENANASATATAEEAPE 128
            |.|:|..:.|::|:.|:..|.:.|||||:..|.|||:...||.....:..:.....:.||..|
 Frog    66 ATDVLAAMEEMEFQRFLTPLKESLEVYRQDQKGKKEATEQKKKDKEKKADSEDQDKSREEENE 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chrac-14NP_476646.2 H4 6..>93 CDD:390056 46/86 (53%)
pole3NP_001017264.1 H4 1..>99 CDD:390056 52/97 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 75 1.000 Domainoid score I8916
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H9694
Inparanoid 1 1.050 115 1.000 Inparanoid score I4682
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1572458at2759
OrthoFinder 1 1.000 - - FOG0004234
OrthoInspector 1 1.000 - - oto105051
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4036
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.