DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chrac-14 and Pole3

DIOPT Version :9

Sequence 1:NP_476646.2 Gene:Chrac-14 / 3772329 FlyBaseID:FBgn0043002 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001007653.1 Gene:Pole3 / 298098 RGDID:1359475 Length:145 Species:Rattus norvegicus


Alignment Length:125 Identity:59/125 - (47%)
Similarity:80/125 - (64%) Gaps:0/125 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTSSSTALAHKQNHKTIT 65
            |.||.||||||||||.|:||||||:..::|||||:||:||||||.::.||.:...|.|...||:.
  Rat     1 MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLN 65

  Fly    66 AKDILQTLTELDFESFVPSLTQDLEVYRKVVKEKKESKASKKDSNTAENANASATATAEE 125
            |.|:|..:.|::|:.||..|.:.||.||:..|.|||:...||.....::......:..||
  Rat    66 ASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKDCEEQDKSREEE 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chrac-14NP_476646.2 H4 6..>93 CDD:390056 46/86 (53%)
Pole3NP_001007653.1 H4 1..>105 CDD:304892 55/103 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..145 9/33 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I8949
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9694
Inparanoid 1 1.050 115 1.000 Inparanoid score I4736
OMA 1 1.010 - - QHG55153
OrthoDB 1 1.010 - - D1572458at2759
OrthoFinder 1 1.000 - - FOG0004234
OrthoInspector 1 1.000 - - oto98356
orthoMCL 1 0.900 - - OOG6_103217
Panther 1 1.100 - - LDO PTHR46172
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4036
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.980

Return to query results.
Submit another query.