DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chrac-14 and php3

DIOPT Version :9

Sequence 1:NP_476646.2 Gene:Chrac-14 / 3772329 FlyBaseID:FBgn0043002 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_593639.1 Gene:php3 / 2542027 PomBaseID:SPAC23C11.08 Length:116 Species:Schizosaccharomyces pombe


Alignment Length:103 Identity:37/103 - (35%)
Similarity:58/103 - (56%) Gaps:6/103 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTSSSTALAHKQNHKTITAKDILQTLT 74
            ||.|.:.|::|.||||:|.:||||:..:....|.|..|||..::....::..||||.:|:|..|.
pombe    12 LPIANVARIMKSALPENAKISKEAKDCVQDCVSEFISFVTGEASEQCTQEKRKTITGEDVLLALN 76

  Fly    75 ELDFESFVPSLTQDLEVYRK------VVKEKKESKASK 106
            .|.||::...|...|..||:      .:||.|:|::.:
pombe    77 TLGFENYAEVLKISLTKYREQQARSASMKETKQSRSEE 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chrac-14NP_476646.2 H4 6..>93 CDD:390056 31/82 (38%)
php3NP_593639.1 CBFD_NFYB_HMF 12..75 CDD:279185 25/62 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.