DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chrac-14 and dpb4

DIOPT Version :9

Sequence 1:NP_476646.2 Gene:Chrac-14 / 3772329 FlyBaseID:FBgn0043002 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_595521.1 Gene:dpb4 / 2540966 PomBaseID:SPBC3D6.09 Length:210 Species:Schizosaccharomyces pombe


Alignment Length:127 Identity:44/127 - (34%)
Similarity:70/127 - (55%) Gaps:3/127 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTSSSTALAHKQNHKTITAKDI 69
            ::||.||.::|.||:|..|||.:.|.|||..|:..:|::|..|:||:|..:|...|.|.:..:|:
pombe    12 LDDLALPRSIIMRLVKGVLPEKSLVQKEALKAMINSATLFVSFLTSASGEIATNNNRKILMPQDV 76

  Fly    70 LQTLTELDFESFVPSLTQDLEVYRKVVKEKKESKASKKDSNTAENANASA---TATAEEAPE 128
            |..|.|:::..|..:|.:.||.|...:|||:....:..|.:..:.|...|   |...||..|
pombe    77 LNALDEIEYPEFSKTLKKHLEAYELALKEKRLKLPNVSDVDNRKKAKIDAHDTTPLDEEKDE 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chrac-14NP_476646.2 H4 6..>93 CDD:390056 33/86 (38%)
dpb4NP_595521.1 H4 13..>109 CDD:304892 37/95 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I3309
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I1863
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004234
OrthoInspector 1 1.000 - - oto101908
orthoMCL 1 0.900 - - OOG6_103217
Panther 1 1.100 - - LDO PTHR46172
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5309
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.990

Return to query results.
Submit another query.