DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His4:CG33895 and H4c4

DIOPT Version :10

Sequence 1:NP_001027317.1 Gene:His4:CG33895 / 3772325 FlyBaseID:FBgn0053895 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_783585.1 Gene:H4c4 / 319156 MGIID:2448423 Length:103 Species:Mus musculus


Alignment Length:72 Identity:17/72 - (23%)
Similarity:31/72 - (43%) Gaps:7/72 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NLLDGSIDDNTKFEDECRAIFGAQSYVLFTLDKLVQKFVKHLHAVASDETD--TKLLQLHAYENY 68
            |.::.|.|.:...::.|..:...|..:..|..:|.|:     ..||:.:.|  .||..|...|.:
Mouse   100 NTIEWSPDWSRLPKELCIKVRKPQKTITGTKQQLKQR-----PKVAASKEDILQKLETLEKEEVH 159

  Fly    69 RKLWEDD 75
            .:..||:
Mouse   160 SEEEEDE 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His4:CG33895NP_001027317.1 PLN00035 1..103 CDD:177669 17/72 (24%)
H4c4NP_783585.1 PLN00035 1..103 CDD:177669 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.