DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33687 and CG33721

DIOPT Version :9

Sequence 1:NP_001027130.2 Gene:CG33687 / 3772322 FlyBaseID:FBgn0053687 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001036743.1 Gene:CG33721 / 3885576 FlyBaseID:FBgn0053721 Length:181 Species:Drosophila melanogaster


Alignment Length:164 Identity:61/164 - (37%)
Similarity:90/164 - (54%) Gaps:12/164 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SHLSFTNLKCEMIDRTFGNFEMCRIKAVNRTHKYIDINLKLYILPINNIMIKLDSKRYTNGYRPF 74
            |.|.|||.||.:.|.|:.:||.|.||:||||:|||.:...:|.:||.|...||...|....|.|.
  Fly    23 SKLEFTNFKCHVKDPTYLSFEYCFIKSVNRTYKYISLKANMYEVPITNASAKLQISRRFRSYMPI 87

  Fly    75 FMSLTFDFCKY------LKNPNQRSMIFLKEIHSTFINASNLNHTCPYNNDITVNKFWTGNLERA 133
            .::.:.|.|||      |.||..|   ..:||...:   :|.||.|||::|:.:::..:..|...
  Fly    88 TIAASIDVCKYMAYKKNLANPMLR---LFEEITKKY---TNTNHKCPYDHDLIIDRLPSKYLSEH 146

  Fly   134 FLRYLPVPNGDYAIFSTWYSSNVPRLLVNTFFQI 167
            |...||:|.|||:..|.|||.|:.|..::.::.:
  Fly   147 FTNILPLPPGDYSFNSIWYSRNIERATISIYYTV 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33687NP_001027130.2 DUF1091 64..147 CDD:284008 28/88 (32%)
CG33721NP_001036743.1 DUF1091 74..160 CDD:284008 30/91 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446128
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.940

Return to query results.
Submit another query.