DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33687 and CG13589

DIOPT Version :9

Sequence 1:NP_001027130.2 Gene:CG33687 / 3772322 FlyBaseID:FBgn0053687 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster


Alignment Length:151 Identity:46/151 - (30%)
Similarity:77/151 - (50%) Gaps:10/151 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TNLKCEMIDRTFGNFEMCRIKAVNRTHKYIDINLKLYILPINNIMIKLDSKRYTNGYRPFFMSLT 79
            ||..|:..::::.....||:||.:||...::|| ..:|.|..||.:.:...:..|||:||....|
  Fly    28 TNAVCKSYNKSWVVVHYCRLKAYSRTKTSLNIN-ATFIEPAKNIYLHMKMMKKANGYKPFLFDYT 91

  Fly    80 FDFCKYLKNPNQRSMIFLKEIHSTFINASNLNHTCPYNNDITVNKFWTGNLERAFLRYLPVPNGD 144
            ||.|::::..||.   |.|.:.:...|.|.:||||||.....::.|...::.      :|:|:||
  Fly    92 FDACEFMRRRNQP---FAKIVWNMIKNVSTVNHTCPYEGLQMLSDFHHIDVP------VPLPSGD 147

  Fly   145 YAIFSTWYSSNVPRLLVNTFF 165
            |.:...|.....|:...|.:|
  Fly   148 YLLLLDWIFDFKPQFATNVYF 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33687NP_001027130.2 DUF1091 64..147 CDD:284008 27/82 (33%)
CG13589NP_611918.2 DM8 83..171 CDD:214778 29/95 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
55.010

Return to query results.
Submit another query.