DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33687 and CG13561

DIOPT Version :10

Sequence 1:NP_001027130.2 Gene:CG33687 / 3772322 FlyBaseID:FBgn0053687 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster


Alignment Length:170 Identity:47/170 - (27%)
Similarity:85/170 - (50%) Gaps:13/170 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWRINVILTSHLSFTNLKCEMIDRTFGNFEMCRIKAVNRTHKYIDINLKLYIL--PINNIMIKLD 63
            :|.| :.:.....|||::|...|..|....:||:.||.|  ..::::|:..||  |...:.:::.
  Fly    13 LWHI-LQVQGVAKFTNIECLSADENFTTVSLCRLYAVKR--DVVEMSLRANILRWPKGPVSMRMQ 74

  Fly    64 SKRYTNGYRPFFMSL-TFDFCKYLKNPNQRSMIFLKEIHSTFINASNLNHTCPYNNDITVNKFWT 127
            ..:..:||:||..:: ..|.|:||:   :|:..|:..|.|:|.|.:|:| .||...:|.:..|  
  Fly    75 LLKKASGYKPFLYNICQSDVCEYLE---KRNHPFINIILSSFGNRTNVN-KCPIPPEIVLEHF-- 133

  Fly   128 GNLERAFLRYLPVPNGDYAIFSTWYSSNVPRLLVNTFFQI 167
             ......|..:|:|.|||.:|:|:.........|..:|.:
  Fly   134 -RFPVKVLDMMPLPFGDYGLFTTFTFHRSELAQVKVYFTL 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33687NP_001027130.2 DUF1091 64..147 CDD:461928 26/83 (31%)
CG13561NP_611830.3 DM8 82..173 CDD:214778 29/98 (30%)

Return to query results.
Submit another query.