DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33687 and CG33919

DIOPT Version :9

Sequence 1:NP_001027130.2 Gene:CG33687 / 3772322 FlyBaseID:FBgn0053687 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster


Alignment Length:149 Identity:37/149 - (24%)
Similarity:74/149 - (49%) Gaps:15/149 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 INVILTSHLSFTNLKCE-MIDRTFGNFEMCRIKAVNRTHKYIDINLKLYILPINNIMIKLD--SK 65
            |..:..:.|.:...|.| :::||..:...|.:||:|.....::::. ..|:|::|.:|::.  :|
  Fly    14 IGQLTNTQLVYKLKKIECLVNRTRVSNVSCHVKAINWNLAVVNMDC-FMIVPLHNPIIRMQVFTK 77

  Fly    66 RYTNGYRPFFMSLTFDFCKYLKNPN--QRSMIFLKEIHSTFINASNLNHTCPYNNDITVNKFWTG 128
            .|:|.|:||.:.:....|:.::..|  ...:|..|    .|...:|:||:||::..:...   .|
  Fly    78 DYSNQYKPFLVDVKIRICEVIERRNFIPYGVIMWK----LFKRYTNVNHSCPFSGHLIAR---DG 135

  Fly   129 NLERAFLRYLPVPNGDYAI 147
            .|:.:.|.  |.|.|.|.:
  Fly   136 FLDTSLLP--PFPQGFYQV 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33687NP_001027130.2 DUF1091 64..147 CDD:284008 23/84 (27%)
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 24/90 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
33.010

Return to query results.
Submit another query.