DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33687 and CG33795

DIOPT Version :10

Sequence 1:NP_001027130.2 Gene:CG33687 / 3772322 FlyBaseID:FBgn0053687 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster


Alignment Length:150 Identity:46/150 - (30%)
Similarity:77/150 - (51%) Gaps:10/150 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 WRINVILTSHLSFTNLKCEMIDRTFGNFEMCRIKAVNRTHKYIDINLKLYILPINNIMIKLDSKR 66
            ||::..:|..|  ||:.||..::::.....||:|||||.....:.|..:: .|.|:::|.....:
  Fly    18 WRLSYSVTYKL--TNVICESRNQSWVTINECRLKAVNRNRTVFNFNATIH-HPTNDVVIDYRFLK 79

  Fly    67 YTNGYRPFFMSLTFDFCKYLKNPNQRSMIFLKEIHSTFINASNLNHTCPYNNDITVNKFWTGNLE 131
            ..|||:|:......|.|::|:.|..   :..|.|:..|...||:|||||:..||.:.    |...
  Fly    80 RENGYKPWLYKKNIDGCRFLRKPYD---MLTKMIYMVFKPFSNINHTCPFYGDILIR----GMYL 137

  Fly   132 RAFLRYLPVPNGDYAIFSTW 151
            |..::.:|.|:|.|.:...|
  Fly   138 RTEIKAMPYPSGKYMLQINW 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33687NP_001027130.2 DUF1091 64..147 CDD:461928 26/82 (32%)
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928 26/82 (32%)

Return to query results.
Submit another query.